5l6q/1/1:A/1:B

Sequences
>5l6q-a1-m1-cA (length=108) [Search sequence]
SELTQDPAVSVALGQTVRITCQGDSLRSYSASWYQQKPGQAPVLVIFRKSNRPSGIPDRF
SGSSSGNTASLTITGAQAEDEADYYCNSRDSSANHQVFGGGTKLTVLG
>5l6q-a1-m1-cB (length=108) [Search sequence]
SELTQDPAVSVALGQTVRITCQGDSLRSYSASWYQQKPGQAPVLVIFRKSNRPSGIPDRF
SGSSSGNTASLTITGAQAEDEADYYCNSRDSSANHQVFGGGTKLTVLG
Structure information
PDB ID 5l6q (database links: RCSB PDB PDBe PDBj PDBsum)
Title Refolded AL protein from cardiac amyloidosis
Assembly ID 1
Resolution 1.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 47
Sequence identity between the two chains 1.0
PubMed citation 28544119
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:5l6qA BioLiP:5l6qB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5l6q-a1-m1-cA_5l6q-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 5l6q-assembly1.cif.gz

[Back to Home]