5lcb/1/1:L/1:N

Sequences
>5lcb-a1-m1-cL (length=59) [Search sequence]
MSGGGVFTDILAAAGRIFEVMVEGHWETVGMLFDSLGKGTMRINRNAYGSMGGGSLRGS
>5lcb-a1-m1-cN (length=59) [Search sequence]
MSGGGVFTDILAAAGRIFEVMVEGHWETVGMLFDSLGKGTMRINRNAYGSMGGGSLRGS
Structure information
PDB ID 5lcb (database links: RCSB PDB PDBe PDBj PDBsum)
Title In situ atomic-resolution structure of the baseplate antenna complex in Chlorobaculum tepidum obtained combining solid-state NMR spectroscopy, cryo electron microscopy and polarization spectroscopy
Assembly ID 1
Resolution 26.5Å
Method of structure determination ELECTRON MICROSCOPY, SOLID-STATE NMR
Number of inter-chain contacts 31
Sequence identity between the two chains 1.0
PubMed citation 27534696
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID L N
UniProt accession P0A314 P0A314
Species 194439 (Chlorobaculum tepidum TLS) 194439 (Chlorobaculum tepidum TLS)
Function annotation BioLiP:5lcbL BioLiP:5lcbN
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5lcb-a1-m1-cL_5lcb-a1-m1-cN.pdb.gz
Full biological assembly
Download: 5lcb-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5lcb/1/1:A/1:E 5lcb/1/1:A/1:M 5lcb/1/1:B/1:H 5lcb/1/1:B/1:J 5lcb/1/1:C/1:G 5lcb/1/1:D/1:F 5lcb/1/1:I/1:K

[Back to Home]