5lcy/1/1:A/1:D

Sequences

>5lcy-a1-m1-cA (length=88) [Search sequence]

PHSPEDKKRILTRVRRIRGQVEALERALESGEPCLAILQQIAAVRGASNGLMSEMVEIHL KDHLVSGETTPDQRAVRMAEIGHLLRAY

>5lcy-a1-m1-cD (length=88) [Search sequence]

PHSPEDKKRILTRVRRIRGQVEALERALESGEPCLAILQQIAAVRGASNGLMSEMVEIHL KDHLVSGETTPDQRAVRMAEIGHLLRAY

Structure information

PDB ID	5lcy (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Formaldehyde-Responsive Regulator FrmR E64H variant from Salmonella enterica serovar Typhimurium
Assembly ID	1
Resolution	2.19Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	50
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	D
UniProt accession	A0A0H3NLH8	A0A0H3NLH8
Species	90371 (Salmonella enterica subsp. enterica serovar Typhimurium)	90371 (Salmonella enterica subsp. enterica serovar Typhimurium)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5lcy-a1-m1-cA_5lcy-a1-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5lcy-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

5lcy/1/1:C/1:D 5lcy/1/1:A/1:B