5lcy/1/1:C/1:D

Sequences
>5lcy-a1-m1-cC (length=88) [Search sequence]
PHSPEDKKRILTRVRRIRGQVEALERALESGEPCLAILQQIAAVRGASNGLMSEMVEIHL
KDHLVSGETTPDQRAVRMAEIGHLLRAY
>5lcy-a1-m1-cD (length=88) [Search sequence]
PHSPEDKKRILTRVRRIRGQVEALERALESGEPCLAILQQIAAVRGASNGLMSEMVEIHL
KDHLVSGETTPDQRAVRMAEIGHLLRAY
Structure information
PDB ID 5lcy (database links: RCSB PDB PDBe PDBj PDBsum)
Title Formaldehyde-Responsive Regulator FrmR E64H variant from Salmonella enterica serovar Typhimurium
Assembly ID 1
Resolution 2.19Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 107
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession A0A0H3NLH8 A0A0H3NLH8
Species 90371 (Salmonella enterica subsp. enterica serovar Typhimurium) 90371 (Salmonella enterica subsp. enterica serovar Typhimurium)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5lcy-a1-m1-cC_5lcy-a1-m1-cD.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 5lcy-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 5lcy/1/1:A/1:D 5lcy/1/1:C/1:B
  • [Back to Home]