5low/1/1:E/1:G

Sequences
>5low-a1-m1-cE (length=56) [Search sequence]
RENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQ
>5low-a1-m1-cG (length=60) [Search sequence]
FARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRA
Structure information
PDB ID 5low (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the Ca2+-bound Rabphilin 3A C2B domain SNAP25 complex (P21 space group)
Assembly ID 1
Resolution 2.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 65
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E G
UniProt accession P60881 P60881
Species 10116 (Rattus norvegicus) 10116 (Rattus norvegicus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5low-a1-m1-cE_5low-a1-m1-cG.pdb.gz
Full biological assembly
Download: 5low-assembly1.cif.gz

[Back to Home]