5lus/5/1:I/1:J

Sequences

>5lus-a5-m1-cI (length=50) [Search sequence]

HMEQQLYAVMDDICKLVDAIPLHELEMLSCAKELLLQRGLRRKLLANAVD

>5lus-a5-m1-cJ (length=50) [Search sequence]

HMEQQLYAVMDDICKLVDAIPLHELEMLSCAKELLLQRGLRRKLLANAVD

Structure information

PDB ID	5lus (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structures of DHBN domain of Pelecanus crispus BLM helicase
Assembly ID	5
Resolution	1.433Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	81
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	I	J
UniProt accession	A0A091SV96	A0A091SV96
Species	36300 (Pelecanus crispus)	36300 (Pelecanus crispus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 5lus-a5-m1-cI_5lus-a5-m1-cJ.pdb.gz

Full biological assembly Download: 5lus-assembly5.cif.gz

Similar dimers

Other dimers with similar sequences and structures

5lus/1/1:A/1:B 5lus/2/1:D/1:C 5lus/3/1:F/1:E 5lus/4/1:G/1:H