5lus/5/1:I/1:J

Sequences
>5lus-a5-m1-cI (length=50) [Search sequence]
HMEQQLYAVMDDICKLVDAIPLHELEMLSCAKELLLQRGLRRKLLANAVD
>5lus-a5-m1-cJ (length=50) [Search sequence]
HMEQQLYAVMDDICKLVDAIPLHELEMLSCAKELLLQRGLRRKLLANAVD
Structure information
PDB ID 5lus (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structures of DHBN domain of Pelecanus crispus BLM helicase
Assembly ID 5
Resolution 1.433Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 81
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID I J
UniProt accession A0A091SV96 A0A091SV96
Species 36300 (Pelecanus crispus) 36300 (Pelecanus crispus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5lus-a5-m1-cI_5lus-a5-m1-cJ.pdb.gz
Full biological assembly
Download: 5lus-assembly5.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5lus/1/1:A/1:B 5lus/2/1:D/1:C 5lus/3/1:F/1:E 5lus/4/1:G/1:H

[Back to Home]