5lut/3/1:C/1:D

Sequences
>5lut-a3-m1-cC (length=51) [Search sequence]
GLHLEQQLYSVEDICKLVDAIPLHELTSISCAKELLQQRELRRKLLADSVD
>5lut-a3-m1-cD (length=53) [Search sequence]
DKGLHLEQQLYSVEDICKLVDAIPLHELTSISCAKELLQQRELRRKLLADSVD
Structure information
PDB ID 5lut (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structures of DHBN domain of Gallus gallus BLM helicase
Assembly ID 3
Resolution 2.72Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 72
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession Q9I920 Q9I920
Species 9031 (Gallus gallus) 9031 (Gallus gallus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5lut-a3-m1-cC_5lut-a3-m1-cD.pdb.gz
Full biological assembly
Download: 5lut-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5lut/2/1:A/1:B 5lut/4/1:E/3:E 5lut/5/1:G/1:F

[Back to Home]