5m58/1/1:B/1:A

Sequences

>5m58-a1-m1-cB (length=229) [Search sequence]

MKIEPITGSEAEAFHRMGSRAFERYNEFVDLLVGAGIADGQTVVDLCCGSGELEIILTSR
FPSLNLVGVDLSEDMVRIARDYAAEQGKELEFRHGDAQSPAGMEDLLGKADLVVSRHAFH
RLTRLPAGFDTMLRLVKPGGAILNVSFLHLSDFDEPGFRTWVRFLKERPWDAEMQVAWAL
AHYYAPRLQDYRDALAQAADETPVSEQRIWVDDQGYGVATVKCFARRAA

>5m58-a1-m1-cA (length=230) [Search sequence]

Structure information

PDB ID	5m58 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of CouO, a C-methyltransferase from Streptomyces rishiriensis
Assembly ID	1
Resolution	2.05Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	16
Sequence identity between the two chains	1.0
PubMed citation	28152088

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q9F8T9	Q9F8T9
Species	68264 (Streptomyces rishiriensis)	68264 (Streptomyces rishiriensis)
Function annotation	BioLiP:5m58B	BioLiP:5m58A

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	5m58-a1-m1-cB_5m58-a1-m1-cA.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	5m58-assembly1.cif.gz