5mj0/1/1:B/1:A

Sequences
>5mj0-a1-m1-cB (length=79) [Search sequence]
GTPEVKVASSEDVDLPCTAPWDPQVPYTVSWVKLLERPYSLKIRNTTSSNSGTYRCTLQD
PDGQRNLSGKVILRVTGSP
>5mj0-a1-m1-cA (length=80) [Search sequence]
PGTPEVKVASSEDVDLPCTAPWDPQVPYTVSWVKLLNERPYSLKIRNTTSSNSGTYRCTL
QDPDGQRNLSGKVILRVTGS
Structure information
PDB ID 5mj0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Extracellular domain of human CD83 - cubic crystal form
Assembly ID 1
Resolution 3.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 22
Sequence identity between the two chains 0.987
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q01151 Q01151
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5mj0-a1-m1-cB_5mj0-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 5mj0-assembly1.cif.gz

[Back to Home]