5mr3/2/1:F/1:H

Sequences

>5mr3-a2-m1-cF (length=107) [Search sequence]

GIDWDVFCSQNENIPAKFISRLVAPVEKMDVDCSNGLVPITHEHGFNMMLIQYTRNKLLD SPGMCVFWGPYSVPKNDTVVLYTVTARLKWSEGPPTDLSIQCYMPKC

>5mr3-a2-m1-cH (length=111) [Search sequence]

GIDWDVFCSQNENIPAKFISRLVAPKCLAVEKMDVDCSNGLVPITHEHGFNMMLIQYTRN KLLDSPGMCVFWGPYSVPKNDTVVLYTVTARLKWSEGPPTDLSIQCYMPKS

Structure information

PDB ID	5mr3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of red abalone egg VERL repeat 2 with linker in complex with sperm lysin at 1.8 A resolution
Assembly ID	2
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	50
Sequence identity between the two chains	0.991

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	F	H
UniProt accession	Q8WR62	Q8WR62
Species	6454 (Haliotis rufescens)	6454 (Haliotis rufescens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5mr3-a2-m1-cF_5mr3-a2-m1-cH.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5mr3-assembly2.cif.gz

Similar dimers