5mw0/1/1:B/1:A

Sequences

>5mw0-a1-m1-cB (length=60) [Search sequence]

SHDCAKVDLENAELRRKLIRTKRAFEDTYEKLRMANKAKAQVEKDIKNQILKTHNVLRNV

>5mw0-a1-m1-cA (length=62) [Search sequence]

GGSHDCAKVDLENAELRRKLIRTKRAFEDTYEKLRMANKAKAQVEKDIKNQILKTHNVLR NV

Structure information

PDB ID	5mw0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Complex between the Leucine Zipper (LZ) and Centrosomin-motif 2 (CM2) domains of Drosophila melanogaster Centrosomin (Cnn) - L535E mutant form
Assembly ID	1
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	57
Sequence identity between the two chains	1.0
PubMed citation	28575671

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	P54623	P54623
Species	7227 (Drosophila melanogaster)	7227 (Drosophila melanogaster)
Function annotation	BioLiP:5mw0B	BioLiP:5mw0A

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 5mw0-a1-m1-cB_5mw0-a1-m1-cA.pdb.gz

Full biological assembly Download: 5mw0-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	5mvw/1/1:A/1:B 5mw9/2/1:E/1:F 5mwe/1/1:A/1:B
Other dimers with similar sequences but different poses	5i7c/2/1:D/1:C 5i7c/1/1:A/1:B