5n76/2/1:B/1:C

Sequences

>5n76-a2-m1-cB (length=63) [Search sequence]

CMAKVVLTKADGGRVEIGDVLEVRAEGGAVRVTTLFDEEHAFPGLAIGRVDLRSGVISLI EEQ

>5n76-a2-m1-cC (length=63) [Search sequence]

CMAKVVLTKADGGRVEIGDVLEVRAEGGAVRVTTLFDEEHAFPGLAIGRVDLRSGVISLI EEQ

Structure information

PDB ID	5n76 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the apo-form of the CO dehydrogenase accessory protein CooT from Rhodospirillum rubrum
Assembly ID	2
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	64
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	P72320	P72320
Species	1085 (Rhodospirillum rubrum)	1085 (Rhodospirillum rubrum)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5n76-a2-m1-cB_5n76-a2-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5n76-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

5n76/1/1:A/1:D 5n76/3/1:F/1:E 6y8v/1/1:A/1:B 6y8w/1/1:A/1:B