5n7y/1/1:A/1:C

Sequences
>5n7y-a1-m1-cA (length=49) [Search sequence]
SMDETVKLNHTCVICDQEKNRGIHLYTKFICLDCERKVISTSTSDPDYA
>5n7y-a1-m1-cC (length=49) [Search sequence]
SMDETVKLNHTCVICDQEKNRGIHLYTKFICLDCERKVISTSTSDPDYA
Structure information
PDB ID 5n7y (database links: RCSB PDB PDBe PDBj PDBsum)
Title Solution structure of B. subtilis Sigma G inhibitor CsfB
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 52
Sequence identity between the two chains 1.0
PubMed citation 29526435
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A C
UniProt accession P37534 P37534
Species 1423 (Bacillus subtilis) 1423 (Bacillus subtilis)
Function annotation BioLiP:5n7yA BioLiP:5n7yC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5n7y-a1-m1-cA_5n7y-a1-m1-cC.pdb.gz
Full biological assembly
Download: 5n7y-assembly1.cif.gz

[Back to Home]