5nnk/1/1:A/2:A

Sequences
>5nnk-a1-m1-cA (length=34) [Search sequence]
LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR
>5nnk-a1-m2-cA (length=34) [Search sequence]
LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR
Structure information
PDB ID 5nnk (database links: RCSB PDB PDBe PDBj PDBsum)
Title The structure of LL-37 crystallized in the presence LDAO
Assembly ID 1
Resolution 1.798Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 24
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P49913 P49913
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5nnk-a1-m1-cA_5nnk-a1-m2-cA.pdb.gz
Full biological assembly
Download: 5nnk-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 7pdc/1/2:B/2:A 7pdc/1/1:B/1:A
    		•

    [Back to Home]