5nnm/1/1:B/1:A

Sequences
>5nnm-a1-m1-cB (length=32) [Search sequence]
LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLV
>5nnm-a1-m1-cA (length=34) [Search sequence]
LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR
Structure information
PDB ID 5nnm (database links: RCSB PDB PDBe PDBj PDBsum)
Title The crystal structure of dimeric LL-37
Assembly ID 1
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 18
Sequence identity between the two chains 1.0
PubMed citation 29133814
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession P49913 P49913
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:5nnmA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5nnm-a1-m1-cB_5nnm-a1-m1-cA.pdb.gz
Full biological assembly
Download: 5nnm-assembly1.cif.gz

[Back to Home]