5nnx/1/2:A/3:A

Sequences
>5nnx-a1-m2-cA (length=74) [Search sequence]
AEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQV
SSHIQVLARRKSRD
>5nnx-a1-m3-cA (length=74) [Search sequence]
AEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQV
SSHIQVLARRKSRD
Structure information
PDB ID 5nnx (database links: RCSB PDB PDBe PDBj PDBsum)
Title TEAD1 bound to DNA
Assembly ID 1
Resolution 3.29Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 25
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID A A
UniProt accession P28347 P28347
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:5nnxA BioLiP:5nnxA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5nnx-a1-m2-cA_5nnx-a1-m3-cA.pdb.gz
Full biological assembly
Download: 5nnx-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5nnx/1/1:A/2:A 5nnx/1/1:A/3:A

[Back to Home]