5nrk/1/1:D/1:B

Sequences

>5nrk-a1-m1-cD (length=67) [Search sequence]

KPGDVDGNGSININDFALMRNYLLGNLKDFPAEDDIKAGDLNGDKSINSLDFAIMRMYLL GMITKFS

>5nrk-a1-m1-cB (length=68) [Search sequence]

KPGDVDGNGSININDFALMRNYLLGNLKDFPAEDDIKAGDLNGDKSINSLDFAIMRMYLL GMITKFSV

Structure information

PDB ID	5nrk (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the sixth cohesin from Acetivibrio cellulolyticus' scaffoldin B in complex with Cel5 dockerin S15I, I16N mutant
Assembly ID	1
Resolution	1.45Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	22
Sequence identity between the two chains	1.0
PubMed citation	29367338

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	B
UniProt accession	A0A2R2JFJ6	A0A2R2JFJ6
Species	35830 (Acetivibrio cellulolyticus)	35830 (Acetivibrio cellulolyticus)
Function annotation	BioLiP:5nrkD	BioLiP:5nrkB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5nrk-a1-m1-cD_5nrk-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5nrk-assembly1.cif.gz