5ob4/1/1:A/1:B

Sequences
>5ob4-a1-m1-cA (length=44) [Search sequence]
GCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRK
>5ob4-a1-m1-cB (length=44) [Search sequence]
GCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRK
Structure information
PDB ID 5ob4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title NMR spatial structure of HER2 TM domain dimer in DPC micelles.
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 20
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P04626 P04626
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5ob4-a1-m1-cA_5ob4-a1-m1-cB.pdb.gz
Full biological assembly
Download: 5ob4-assembly1.cif.gz

[Back to Home]