5oll/1/2:A/3:A

Sequences
>5oll-a1-m2-cA (length=35) [Search sequence]
EQCVKKDELCIPYYLDCCEPLECKKVNWWDHKCIG
>5oll-a1-m3-cA (length=35) [Search sequence]
EQCVKKDELCIPYYLDCCEPLECKKVNWWDHKCIG
Structure information
PDB ID 5oll (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of gurmarin, a sweet taste suppressing polypeptide
Assembly ID 1
Resolution 1.45Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 26
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID A A
UniProt accession P25810 P25810
Species 4068 (Gymnema sylvestre) 4068 (Gymnema sylvestre)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5oll-a1-m2-cA_5oll-a1-m3-cA.pdb.gz
Full biological assembly
Download: 5oll-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5oll/1/1:A/2:A 5oll/1/1:A/3:A

[Back to Home]