5oqw/1/1:A/1:B

Sequences

>5oqw-a1-m1-cA (length=106) [Search sequence]

NFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLT DWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVR

>5oqw-a1-m1-cB (length=107) [Search sequence]

MNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGL TDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVR

Structure information

PDB ID	5oqw (database links: RCSB PDB PDBe PDBj PDBsum)
Title	XIAP in complex with small molecule
Assembly ID	1
Resolution	2.31Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	43
Sequence identity between the two chains	1.0
PubMed citation	29695633

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P98170	P98170
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:5oqwA	BioLiP:5oqwB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 5oqw-a1-m1-cA_5oqw-a1-m1-cB.pdb.gz

Full biological assembly Download: 5oqw-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

3cm2/5/1:E/1:G 2opz/1/1:A/1:C 2opz/2/1:B/1:D 3clx/5/1:C/1:A 3clx/6/1:B/2:D 3cm2/1/1:D/2:F 3cm2/2/1:A/3:J 3cm2/3/1:H/1:B 3cm2/4/1:C/1:I 3cm7/1/1:D/1:B 3cm7/2/1:A/2:C 3eyl/1/1:A/1:B 4ec4/5/1:L/1:E 4ec4/1/1:F/1:A 4ec4/2/1:B/1:G 4ec4/3/1:C/1:J 4ec4/4/1:D/1:K 4hy0/3/1:E/1:D 4hy0/1/1:A/1:B 4hy0/2/1:H/1:C 4hy0/4/1:F/1:G