5ot5/1/1:B/1:A

Sequences

>5ot5-a1-m1-cB (length=325) [Search sequence]

GPVPSRARVYTDVNTHRPSEYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNN
EKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFK
QLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFY
HPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQL
VRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLD
KLLRYDHQSRLTAREAMEHPYFYTV

>5ot5-a1-m1-cA (length=326) [Search sequence]

Structure information

PDB ID	5ot5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The crystal structure of CK2alpha in complex with compound 24
Assembly ID	1
Resolution	1.63Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	31
Sequence identity between the two chains	1.0
PubMed citation	29732088

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	P68400	P68400
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:5ot5B	BioLiP:5ot5A

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	5ot5-a1-m1-cB_5ot5-a1-m1-cA.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	5ot5-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	5cu3/1/1:B/1:A 5oqu/1/1:A/1:B 5orj/1/1:B/1:A 5ork/1/1:B/1:A 5otd/1/1:B/1:A 5oth/1/1:B/1:A 5otl/1/1:A/1:B 5oto/1/1:B/1:A 5otp/1/1:B/1:A 5oum/1/1:A/1:B 5ouu/1/1:A/1:B
Other dimers with similar sequences but different poses	5t1h/4/1:B/3:A 3u9c/3/1:A/2:B 8p07/1/1:A/1:B 5t1h/3/1:B/2:A 5kwh/3/1:A/2:B 7ay9/3/1:B/2:A