5suy/1/1:B/1:A

Sequences
>5suy-a1-m1-cB (length=94) [Search sequence]
SGLSVHTDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERRE
ARKYASGLLKAGLIRHTVNKITFSEQCYYVFGDL
>5suy-a1-m1-cA (length=95) [Search sequence]
SGLSVHTDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERRE
ARKYASGLLKAGLIRHTVNKITFSEQCYYVFGDLS
Structure information
PDB ID 5suy (database links: RCSB PDB PDBe PDBj PDBsum)
Title Domain-swapped dimer of human Dishevelled2 DEP domain: monoclinic crystal form crystallised from dimeric fraction
Assembly ID 1
Resolution 1.88Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 154
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession O14641 O14641
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5suy-a1-m1-cB_5suy-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 5suy-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5lnp/1/1:A/1:B 5lnp/1/1:D/1:C 5suy/1/1:D/1:C 5suz/1/1:A/1:B 5suz/1/2:A/2:B
Other dimers with similar sequences but different poses
  • 5suz/1/1:A/2:B 5suz/1/1:B/2:A
  • [Back to Home]