5svh/3/1:B/4:B

Sequences
>5svh-a3-m1-cB (length=42) [Search sequence]
NILPSDIMDFVLKNTPSMQALGESPESKEKRIKELELLLMST
>5svh-a3-m4-cB (length=42) [Search sequence]
NILPSDIMDFVLKNTPSMQALGESPESKEKRIKELELLLMST
Structure information
PDB ID 5svh (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the KIX domain of CBP in complex with a MLL/c-Myb chimera
Assembly ID 3
Resolution 2.05Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 34
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 4
Chain ID B B
UniProt accession P01103 P01103
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5svh-a3-m1-cB_5svh-a3-m4-cB.pdb.gz
Full biological assembly
Download: 5svh-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5svh/2/1:B/4:B 5svh/2/2:B/6:B 5svh/2/3:B/5:B

[Back to Home]