5szb/2/1:A/2:A

Sequences

>5szb-a2-m1-cA (length=115) [Search sequence]

GTVIPNNYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQC IECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELLK

>5szb-a2-m2-cA (length=115) [Search sequence]

GTVIPNNYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQC IECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELLK

Structure information

PDB ID	5szb (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of human Dpf3 double-PHD domain bound to histone H3 tail peptide with acetylated K14
Assembly ID	2
Resolution	1.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	50
Sequence identity between the two chains	1.0
PubMed citation	29255264

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	A	A
UniProt accession	Q92784	Q92784
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:5szbA	BioLiP:5szbA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5szb-a2-m1-cA_5szb-a2-m2-cA.pdb.gz

Full biological assembly Download: 5szb-assembly2.cif.gz

Similar dimers