5t9p/6/1:D/1:C

Sequences

>5t9p-a6-m1-cD (length=91) [Search sequence]

EYSGIIYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKEDAMI AQESMNNYLLMGHLLQVRVLPKGAKIEKLYK

>5t9p-a6-m1-cC (length=106) [Search sequence]

LEEYSGIIYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKEDA MIAQESMNNYLLMGHLLQVRVLPKGAKIEKLYKYKKRVLVEKGITK

Structure information

PDB ID	5t9p (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structural analysis reveals the flexible C-terminus of Nop15 undergoes rearrangement to recognize a pre-ribosomal RNA folding intermediate
Assembly ID	6
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	42
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	C
UniProt accession	P53927	P53927
Species	559292 (Saccharomyces cerevisiae S288C)	559292 (Saccharomyces cerevisiae S288C)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5t9p-a6-m1-cD_5t9p-a6-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5t9p-assembly6.cif.gz

Similar dimers