5tgx/3/1:C/1:D

Sequences

>5tgx-a3-m1-cC (length=221) [Search sequence]

NFKKYEENLVASIEEVIQRIIDDKHRPNIIGKTRVGAEVSDYLEDEFVKYISSGKSSSLY
DAQGAPKEKTKNPWDARCKFKFDREEEIWIDFKAFKITNDSNPDIGTPNKIVKFIHEGNF
YLVFVLVYYESKQDGVEFVKYNNDYKKVYLLKDVNESFRINPKPQQVNIAAEPTYRTREE
FIHFFVKKWKESFERQIKSLEKKEILKDLEDKLKNSNDNSI

>5tgx-a3-m1-cD (length=221) [Search sequence]

Structure information

PDB ID	5tgx (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Restriction/modification system-Type II R-SwaI complexed with partially cleaved DNA
Assembly ID	3
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	116
Sequence identity between the two chains	1.0
PubMed citation	28180307

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	A0A1S4NYF7	A0A1S4NYF7
Species	1292 (Staphylococcus warneri)	1292 (Staphylococcus warneri)
Function annotation	BioLiP:5tgxC	BioLiP:5tgxD

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	5tgx-a3-m1-cC_5tgx-a3-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	5tgx-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures

5tgx/1/1:A/1:B 5tgx/1/1:C/1:D 5tgx/2/1:A/1:B 5th3/1/1:A/1:B 5th3/2/1:C/1:D