5th5/2/1:B/1:C

Sequences

>5th5-a2-m1-cB (length=241) [Search sequence]

KGIPVLEIFGPTIQGEGMVIGQKTMFVRTAGCDYSCSWCDSAFTWDGSAKKDIRWMTAEE
IFAELKDIGGDAFSHVTISGGNPALLKQLDAFIELLKENNIRAALETQGTVYQDWFTLID
DLTISPKPPSSKMVTNFQKLDHILTSLQENDRQHAVSLKVVIFNDEDLEFAKTVHKRYPG
IPFYLQVGNDDVHTTDDQSLIAHLLGKYEALVDKVAVDAELNLVRVLPQLHTLLWGNKRG
V

>5th5-a2-m1-cC (length=241) [Search sequence]

Structure information

PDB ID	5th5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of QueE from Bacillus subtilis with 6-carboxypterin-5'-deoxyadenosyl ester bound
Assembly ID	2
Resolution	2.407Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	96
Sequence identity between the two chains	1.0
PubMed citation	28045519

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	O31677	O31677
Species	1423 (Bacillus subtilis)	1423 (Bacillus subtilis)
Function annotation	BioLiP:5th5B	BioLiP:5th5C

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	5th5-a2-m1-cB_5th5-a2-m1-cC.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	5th5-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

5tgs/1/1:A/1:B 5th5/1/1:A/1:D