5tn2/1/1:C/1:D

Sequences
>5tn2-a1-m1-cC (length=47) [Search sequence]
GSHMEYDGQLDSEWEKLVRDAMTSGVSKKQFREFLDYQKWRKSQKEE
>5tn2-a1-m1-cD (length=47) [Search sequence]
GSHMEYDGQLDSEWEKLVRDAMTSGVSKKQFREFLDYQKWRKSQKEE
Structure information
PDB ID 5tn2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Solution Structure of the C-terminal multimerization domain of the master biofilm-regulator SinR from Bacillus subtilis
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 94
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession P06533 P06533
Species 224308 (Bacillus subtilis subsp. subtilis str. 168) 224308 (Bacillus subtilis subsp. subtilis str. 168)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5tn2-a1-m1-cC_5tn2-a1-m1-cD.pdb.gz
Full biological assembly
Download: 5tn2-assembly1.cif.gz
Similar dimers

[Back to Home]