5tnq/2/1:A/1:B

Sequences

>5tnq-a2-m1-cA (length=293) [Search sequence]

AEEFPVPNGFESAYREVDGVKLHYVKGGQGPLVMLVHGFGQTWYEWHQLMPELAKRFTVI
APDLPGLGQSEPPKTGYSGEQVAVYLHKLARQFSPDRPFDLVAHDIGIWNTYPMVVKNQA
DIARLVYMQAPIPDARIYRFPAFTAQGESLVWHFSFFAADDRLAETLIAGKERFFLEHFI
KSHASNTEVFSERLLDLYARSYAKPHSLNASFEYYRALNESVRQNAELAKTRLQMPTMTL
AGGGHGGMGTFQLEQMKAYAEDVEGHVLPGCGHWLPEECAAPMNRLVIDFLSR

>5tnq-a2-m1-cB (length=293) [Search sequence]

Structure information

PDB ID	5tnq (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the E153Q mutant of the CFTR inhibitory factor Cif containing the adducted (R)-Styrene oxide hydrolysis intermediate
Assembly ID	2
Resolution	1.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	100
Sequence identity between the two chains	1.0
PubMed citation	28392259

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	A0A0H2ZD27	A0A0H2ZD27
Species	208963 (Pseudomonas aeruginosa UCBPP-PA14)	208963 (Pseudomonas aeruginosa UCBPP-PA14)
Function annotation	BioLiP:5tnqA	BioLiP:5tnqB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	5tnq-a2-m1-cA_5tnq-a2-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	5tnq-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3kd2/1/1:A/1:B 3kd2/2/1:C/1:D 3kda/1/1:C/1:D 3kda/2/1:A/1:B 3pi6/1/1:B/1:A 3pi6/2/1:C/1:D 4dln/1/1:A/1:B 4dln/2/1:D/1:C 4dm7/1/1:B/1:A 4dm7/2/1:D/1:C 4dmc/1/1:A/1:B 4dmc/2/1:C/1:D 4dmf/1/1:A/1:B 4dmf/2/1:C/1:D 4dmh/1/1:B/1:A 4dmh/2/1:C/1:D 4dmk/1/1:A/1:B 4dmk/2/1:D/1:C 4dnf/1/1:A/1:B 4dnf/2/1:C/1:D 4dno/1/1:B/1:A 4dno/2/1:D/1:C 4ehb/1/1:A/1:B 4ehb/2/1:C/1:D 4eus/1/1:A/1:B 4eus/2/1:C/1:D 4yx9/1/1:A/1:B 4yx9/2/1:C/1:D 5hk9/1/1:A/1:B 5hk9/2/1:C/1:D 5hka/1/1:B/1:A 5hka/2/1:C/1:D 5hkb/1/1:A/1:B 5hkb/2/1:C/1:D 5jyc/1/1:A/1:B 5jyc/2/1:C/1:D 5tnd/1/1:C/1:D 5tnd/2/1:A/1:B 5tne/1/1:B/1:A 5tne/2/1:D/1:C 5tnf/1/1:A/1:B 5tnf/2/1:C/1:D 5tng/1/1:B/1:A 5tng/2/1:C/1:D 5tnh/1/1:C/1:D 5tnh/2/1:A/1:B 5tni/1/1:B/1:A 5tni/2/1:C/1:D 5tnj/1/1:B/1:A 5tnj/2/1:C/1:D 5tnk/1/1:B/1:A 5tnk/2/1:C/1:D 5tnl/1/1:A/1:B 5tnl/2/1:C/1:D 5tnm/1/1:A/1:B 5tnm/2/1:C/1:D 5tnn/1/1:A/1:B 5tnn/2/1:C/1:D 5tnp/1/1:A/1:B 5tnp/2/1:C/1:D 5tnq/1/1:C/1:D 5tnr/1/1:C/1:D 5tnr/2/1:A/1:B 5tns/1/1:A/1:B 5tns/2/1:C/1:D