5toh/1/1:A/1:C

Sequences

>5toh-a1-m1-cA (length=52) [Search sequence]

GDIIWDQLIVKRTLADLLIPINRQISDIQSTLSEVTTRVHEIERQLHEITPV

>5toh-a1-m1-cC (length=53) [Search sequence]

DIIWDQLIVKRTLADLLIPINRQISDIQSTLSEVTTRVHEIERQLHEITPVLK

Structure information

PDB ID	5toh (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of the Marburg Virus VP35 Oligomerization Domain I2
Assembly ID	1
Resolution	2.01Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	48
Sequence identity between the two chains	0.981

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	C
UniProt accession	P35259	P35259
Species	33727 (Marburg virus - Musoke, Kenya, 1980)	33727 (Marburg virus - Musoke, Kenya, 1980)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5toh-a1-m1-cA_5toh-a1-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5toh-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	5toh/1/1:A/1:B 5toi/1/1:A/1:C
Other dimers with similar sequences but different poses	5toi/1/1:B/1:C 5toi/1/1:A/1:B