5toh/1/1:A/1:C

Sequences
>5toh-a1-m1-cA (length=52) [Search sequence]
GDIIWDQLIVKRTLADLLIPINRQISDIQSTLSEVTTRVHEIERQLHEITPV
>5toh-a1-m1-cC (length=53) [Search sequence]
DIIWDQLIVKRTLADLLIPINRQISDIQSTLSEVTTRVHEIERQLHEITPVLK
Structure information
PDB ID 5toh (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the Marburg Virus VP35 Oligomerization Domain I2
Assembly ID 1
Resolution 2.01Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 48
Sequence identity between the two chains 0.981
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A C
UniProt accession P35259 P35259
Species 33727 (Marburg virus - Musoke, Kenya, 1980) 33727 (Marburg virus - Musoke, Kenya, 1980)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5toh-a1-m1-cA_5toh-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 5toh-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5toh/1/1:A/1:B 5toi/1/1:A/1:C
Other dimers with similar sequences but different poses
  • 5toi/1/1:B/1:C 5toi/1/1:A/1:B
  • [Back to Home]