5toh/1/1:C/1:B

Sequences
>5toh-a1-m1-cC (length=53) [Search sequence]
DIIWDQLIVKRTLADLLIPINRQISDIQSTLSEVTTRVHEIERQLHEITPVLK
>5toh-a1-m1-cB (length=70) [Search sequence]
GDIIWDQLIVKRTLADLLIPINRQISDIQSTLSEVTTRVHEIERQLHEITPVLKMGRTLE
AISKGMSEML
Structure information
PDB ID 5toh (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the Marburg Virus VP35 Oligomerization Domain I2
Assembly ID 1
Resolution 2.01Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 32
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C B
UniProt accession P35259 P35259
Species 33727 (Marburg virus - Musoke, Kenya, 1980) 33727 (Marburg virus - Musoke, Kenya, 1980)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5toh-a1-m1-cC_5toh-a1-m1-cB.pdb.gz
Full biological assembly
Download: 5toh-assembly1.cif.gz

[Back to Home]