5twx/5/1:D/1:B

Sequences

>5twx-a5-m1-cD (length=109) [Search sequence]

ESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYK SVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQAALLG

>5twx-a5-m1-cB (length=111) [Search sequence]

ESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYK SVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQAALLGNE

Structure information

PDB ID	5twx (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of BRD9 bromodomain
Assembly ID	5
Resolution	2.55Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	10
Sequence identity between the two chains	1.0
PubMed citation	28418626

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	B
UniProt accession	Q9H8M2	Q9H8M2
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:5twxD	BioLiP:5twxB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5twx-a5-m1-cD_5twx-a5-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5twx-assembly5.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

5igm/1/1:B/1:A 3hme/1/1:A/1:B 5ign/1/1:A/1:B 5twx/5/1:B/1:A 5twx/5/1:C/1:D 6v0s/1/1:A/2:B 6v1b/3/2:B/1:A