5u96/2/1:C/1:D

Sequences
>5u96-a2-m1-cC (length=46) [Search sequence]
SLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYEA
>5u96-a2-m1-cD (length=50) [Search sequence]
SLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYEAQIEA
Structure information
PDB ID 5u96 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the coiled-coil domain from Listeria Innocua (Tetragonal Form)
Assembly ID 2
Resolution 1.95Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 24
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession Q928V6 Q928V6
Species 1642 (Listeria innocua) 1642 (Listeria innocua)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5u96-a2-m1-cC_5u96-a2-m1-cD.pdb.gz
Full biological assembly
Download: 5u96-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5u96/4/1:G/1:H 5udo/2/1:C/1:D 5udo/4/1:G/1:H
Other dimers with similar sequences but different poses
  • 5u96/1/1:B/1:A 5uae/1/1:B/1:A 5uae/2/1:D/1:C 5udo/1/1:A/1:B 5udo/3/1:E/1:F
  • [Back to Home]