5uhj/2/1:B/3:B

Sequences

>5uhj-a2-m1-cB (length=119) [Search sequence]

AISHIGTIDVFVNDQDKAIDFYVNTLGFELREDQAFGPRWVEVAPAGSQTRIVLCTKHFP VYEEGKIGRFTDIQLVTEDIKATHEELVRRGVNFTRAPEQANASFQDPDGNEFLLLQPS

>5uhj-a2-m3-cB (length=119) [Search sequence]

AISHIGTIDVFVNDQDKAIDFYVNTLGFELREDQAFGPRWVEVAPAGSQTRIVLCTKHFP VYEEGKIGRFTDIQLVTEDIKATHEELVRRGVNFTRAPEQANASFQDPDGNEFLLLQPS

Structure information

PDB ID	5uhj (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The crystal structure of a natural product biosynthetic enzyme from Streptomyces sp. CB03234
Assembly ID	2
Resolution	1.75Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	107
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	3
Chain ID	B	B
UniProt accession	A0A125SA24	A0A125SA24
Species	1703937 (Streptomyces sp. CB03234)	1703937 (Streptomyces sp. CB03234)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5uhj-a2-m1-cB_5uhj-a2-m3-cB.pdb.gz

Full biological assembly Download: 5uhj-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

5uhj/1/1:A/2:A 5umq/1/1:A/1:B