5uhj/2/1:B/3:B

Sequences
>5uhj-a2-m1-cB (length=119) [Search sequence]
AISHIGTIDVFVNDQDKAIDFYVNTLGFELREDQAFGPRWVEVAPAGSQTRIVLCTKHFP
VYEEGKIGRFTDIQLVTEDIKATHEELVRRGVNFTRAPEQANASFQDPDGNEFLLLQPS
>5uhj-a2-m3-cB (length=119) [Search sequence]
AISHIGTIDVFVNDQDKAIDFYVNTLGFELREDQAFGPRWVEVAPAGSQTRIVLCTKHFP
VYEEGKIGRFTDIQLVTEDIKATHEELVRRGVNFTRAPEQANASFQDPDGNEFLLLQPS
Structure information
PDB ID 5uhj (database links: RCSB PDB PDBe PDBj PDBsum)
Title The crystal structure of a natural product biosynthetic enzyme from Streptomyces sp. CB03234
Assembly ID 2
Resolution 1.75Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 107
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 3
Chain ID B B
UniProt accession A0A125SA24 A0A125SA24
Species 1703937 (Streptomyces sp. CB03234) 1703937 (Streptomyces sp. CB03234)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5uhj-a2-m1-cB_5uhj-a2-m3-cB.pdb.gz
Full biological assembly
Download: 5uhj-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5uhj/1/1:A/2:A 5umq/1/1:A/1:B

[Back to Home]