5usr/2/1:F/1:D

Sequences

>5usr-a2-m1-cF (length=75) [Search sequence]

SSRAQVLALYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDL GVIRRQVHIGQLYST

>5usr-a2-m1-cD (length=80) [Search sequence]

SSRAQVLALYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDL GVIRRQVHIGQLYSTDKLII

Structure information

PDB ID	5usr (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of human NFS1-ISD11 in complex with E. coli acyl-carrier protein at 3.09 angstroms
Assembly ID	2
Resolution	3.09Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	10
Sequence identity between the two chains	1.0
PubMed citation	28634302

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	F	D
UniProt accession	Q9HD34	Q9HD34
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:5usrF	BioLiP:5usrD

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 5usr-a2-m1-cF_5usr-a2-m1-cD.pdb.gz

Full biological assembly Download: 5usr-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

6uxe/1/1:B/2:B 5wkp/1/1:B/1:F 5wlw/1/1:B/1:F 6w1d/1/1:B/2:B 7rtk/1/1:B/2:B