5v0s/1/1:A/1:B

Sequences

>5v0s-a1-m1-cA (length=68) [Search sequence]

HDLYVDVLDKVGALAHVTSILAREEISITNLQILEAREGLLGVLRISFQREEDRKAKLAL GEEKYQTY

>5v0s-a1-m1-cB (length=68) [Search sequence]

HDLYVDVLDKVGALAHVTSILAREEISITNLQILEAREGLLGVLRISFQREEDRKAKLAL GEEKYQTY

Structure information

PDB ID	5v0s (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the ACT domain of prephenate dehydrogenase tyrA from Bacillus anthracis
Assembly ID	1
Resolution	2.01Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	51
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q81P63	Q81P63
Species	1392 (Bacillus anthracis)	1392 (Bacillus anthracis)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5v0s-a1-m1-cA_5v0s-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5v0s-assembly1.cif.gz