5vb9/1/1:A/2:A

Sequences
>5vb9-a1-m1-cA (length=108) [Search sequence]
GDKNFPRTVMVNLNIHNSDYYDRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNV
DYHMNSVPIQQEILVLRREPPHSPNSFRLEKILVSVGCTCVTPIVHHV
>5vb9-a1-m2-cA (length=108) [Search sequence]
GDKNFPRTVMVNLNIHNSDYYDRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNV
DYHMNSVPIQQEILVLRREPPHSPNSFRLEKILVSVGCTCVTPIVHHV
Structure information
PDB ID 5vb9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title IL-17A in complex with peptide
Assembly ID 1
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 151
Sequence identity between the two chains 1.0
PubMed citation 29329326
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession Q16552 Q16552
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:5vb9A BioLiP:5vb9A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5vb9-a1-m1-cA_5vb9-a1-m2-cA.pdb.gz
Full biological assembly
Download: 5vb9-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4hr9/1/1:B/1:A 5hhx/1/1:A/2:A 5n7w/1/1:Y/1:X 5vb9/2/1:B/2:B 7ama/1/1:B/1:A 7wkx/1/1:E/1:F 7z2m/1/1:K/1:J

[Back to Home]