5vfx/1/1:D/1:C

Sequences

>5vfx-a1-m1-cD (length=99) [Search sequence]

KDLNLYAKELVDVVNYLMKKNQLVFSRNNKFIYVNTETIKSMLEKRNYDTVDGKLYLWRE LEWIECAEDRFNKRIKIDGENMYAVVIKYSSYSILKRLY

>5vfx-a1-m1-cC (length=100) [Search sequence]

KDLNLYAKELVDVVNYLMKKNQLVFSRNNKFIYVNTETIKSMLEKRNYDTVDGKLYLWRE LEWIECAEDRFNKRIKIDGENMYAVVIKYSSYSILKRLYL

Structure information

PDB ID	5vfx (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of an accessory protein of the pCW3 relaxosome in complex with the origin of transfer (oriT) DNA
Assembly ID	1
Resolution	2.81Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	31
Sequence identity between the two chains	1.0
PubMed citation	30213934

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	C
UniProt accession	Q1PLI2	Q1PLI2
Species	1502 (Clostridium perfringens)	1502 (Clostridium perfringens)
Function annotation	BioLiP:5vfxD	BioLiP:5vfxC

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5vfx-a1-m1-cD_5vfx-a1-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5vfx-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

5vfx/1/1:A/1:B 5vfx/2/1:E/1:F 5vfx/2/1:H/1:G 5vfy/1/1:A/1:B 5vfy/2/1:C/1:D