5vjx/4/2:T/2:S

Sequences

>5vjx-a4-m2-cT (length=41) [Search sequence]

PEFSAQLGAQHLKDQLEQRTRIEANIHRQQEELRKIQEQLQ

>5vjx-a4-m2-cS (length=46) [Search sequence]

GADPEFSAQLGAQHLKDQLEQRTRIEANIHRQQEELRKIQEQLQVH

Structure information

PDB ID	5vjx (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the CLOCK Transcription Domain Exon19 in Complex with a Repressor
Assembly ID	4
Resolution	2.695Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	29
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	T	S
UniProt accession	O08785	O08785
Species	10090 (Mus musculus)	10090 (Mus musculus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5vjx-a4-m2-cT_5vjx-a4-m2-cS.pdb.gz

Full biological assembly Download: 5vjx-assembly4.cif.gz

Similar dimers

Other dimers with similar sequences and structures

5vji/1/1:B/1:A 5vji/2/1:D/1:E 5vjx/1/1:c/1:b 5vjx/2/1:F/1:E 5vjx/2/1:K/1:L 5vjx/3/1:I/1:H 5vjx/3/1:V/1:W 5vjx/4/1:N/1:O 5vjx/5/1:e/1:f