5vyk/1/1:A/1:C

Sequences

>5vyk-a1-m1-cA (length=202) [Search sequence]

AASRALQQCGQLQKLIDISIGSLRGLRTKCAVSNDLTQQEIRTLEAKLVRYICKQRQCKL
SVAPGERTPELNSYPRFSDWLYTFNVRPEVVQEIPRDLTLDALLEMNEAKVKETLRRCGA
SGDECGRLQYALTCLRKVTAIPEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAY
EEYTSKLDALQQREQQLLESLG

>5vyk-a1-m1-cC (length=203) [Search sequence]

Structure information

PDB ID	5vyk (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the BRS domain of BRAF in complex with the CC-SAM domain of KSR1
Assembly ID	1
Resolution	1.749Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	197
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	C
UniProt accession	P15056	P15056
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	5vyk-a1-m1-cA_5vyk-a1-m1-cC.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	5vyk-assembly1.cif.gz