5wam/1/2:B/1:A

Sequences
>5wam-a1-m2-cB (length=97) [Search sequence]
SLFPSYKLKIIQGNELEPRAVAALRPGMTKDQVLLLLGSPILRDAFHTDRWDYTFNTSRN
GIIKERSNLTVYFENGVLVRTEGDALQNAAEALRAKQ
>5wam-a1-m1-cA (length=103) [Search sequence]
VSLFPSYKLKIIQGNELEPRAVAALRPGMTKDQVLLLLGSPILRDAFHTDRWDYTFNTSR
NGIIKERSNLTVYFENGVLVRTEGDALQNAAEALRAKQNADKQ
Structure information
PDB ID 5wam (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of BamE from Neisseria gonorrhoeae
Assembly ID 1
Resolution 2.45Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 26
Sequence identity between the two chains 1.0
PubMed citation 29229778
Chain information
Chain 1 Chain 2
Model ID 2 1
Chain ID B A
UniProt accession Q5F5Y8 Q5F5Y8
Species 242231 (Neisseria gonorrhoeae FA 1090) 242231 (Neisseria gonorrhoeae FA 1090)
Function annotation BioLiP:5wamB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5wam-a1-m2-cB_5wam-a1-m1-cA.pdb.gz
Full biological assembly
Download: 5wam-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 5wam/1/2:B/2:A 5wam/1/1:B/1:A
  • [Back to Home]