5wdm/1/1:C/1:B

Sequences

>5wdm-a1-m1-cC (length=44) [Search sequence]

HLCGSHLVEALYLVCGERGFFYTGIVEQCCHSICSLEQLENYCN

>5wdm-a1-m1-cB (length=46) [Search sequence]

QHLCGSHLVEALYLVCGERGFFYTPGIVEQCCHSICSLEQLENYCN

Structure information

PDB ID	5wdm (database links: RCSB PDB PDBe PDBj PDBsum)
Title	An ultra-stable single-chain insulin analog resists thermal inactivation and exhibits biological signaling duration equivalent to the native protein
Assembly ID	1
Resolution	2.803Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	15
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	B
UniProt accession	P01308	P01308
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5wdm-a1-m1-cC_5wdm-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5wdm-assembly1.cif.gz