5wdm/1/1:F/1:E

Sequences
>5wdm-a1-m1-cF (length=44) [Search sequence]
HLCGSHLVEALYLVCGERGFFYTGIVEQCCHSICSLEQLENYCN
>5wdm-a1-m1-cE (length=47) [Search sequence]
QHLCGSHLVEALYLVCGERGFFYTPRGIVEQCCHSICSLEQLENYCN
Structure information
PDB ID 5wdm (database links: RCSB PDB PDBe PDBj PDBsum)
Title An ultra-stable single-chain insulin analog resists thermal inactivation and exhibits biological signaling duration equivalent to the native protein
Assembly ID 1
Resolution 2.803Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 34
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID F E
UniProt accession P01308 P01308
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5wdm-a1-m1-cF_5wdm-a1-m1-cE.pdb.gz
Full biological assembly
Download: 5wdm-assembly1.cif.gz

[Back to Home]