5wrj/1/1:A/1:B

Sequences

>5wrj-a1-m1-cA (length=275) [Search sequence]

AYHKDMPLIFIGGVPRSGTTLMRAMLDAHPDIRCGEETRVIPRILALKQMWSRSSKEKIR
LDEAGVTDEVLDSAMQAFLLEIIVKHGEPAPYLCNKDPFALKSLTYLSRLFPNAKFLLMV
RDGRASVHSMISRKVTIAGFDLNSYRDCLTKWNRAIETMYNQCMEVGYKKCMLVHYEQLV
LHPERWMRTLLKFLQIPWNHSVLHHEEMIGKAGGVSLSKVERSTDQVIKPVNVGALSKWV
GKIPPDVLQDMAVIAPMLAKLGYDPYANPPNYGKP

>5wrj-a1-m1-cB (length=275) [Search sequence]

Structure information

PDB ID	5wrj (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of human tyrosylprotein sulfotransferase-1 complexed with PAP and gastrin peptide
Assembly ID	1
Resolution	2.31Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	111
Sequence identity between the two chains	1.0
PubMed citation	28821720

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	O60507	O60507
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:5wrjA	BioLiP:5wrjB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	5wrj-a1-m1-cA_5wrj-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	5wrj-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

5wri/1/1:B/1:A 5wrj/2/1:C/1:D