5wrt/1/1:B/1:A

Sequences

>5wrt-a1-m1-cB (length=232) [Search sequence]

VYRRLVSGTEGEKDFRVLLSKKSGERLSPWHDIPLFPNGRDARPLLFNMVVEIPKNTRRK
MEMQLRLPFTPIMQDLKKDGSLREYASTLYWNYGAFPQTWEDPREPGGREVFHARGDGDP
LDVVEIGSEVLPVGGVVPVKVLGALAMIDGGELDWKVLAIREGDPLFSQLNSVADVERLC
RGVVPGIREWFRWYKLPTDNVVNQFGHDEAALPAADAERVVYRAHEHYLRLL

>5wrt-a1-m1-cA (length=235) [Search sequence]

Structure information

PDB ID	5wrt (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of type I inorganic pyrophosphatase from Toxoplasma gondii.
Assembly ID	1
Resolution	2.348Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	53
Sequence identity between the two chains	1.0
PubMed citation	28701714

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q4VUZ3	Q4VUZ3
Species	5811 (Toxoplasma gondii)	5811 (Toxoplasma gondii)
Function annotation	BioLiP:5wrtB	BioLiP:5wrtA

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	5wrt-a1-m1-cB_5wrt-a1-m1-cA.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	5wrt-assembly1.cif.gz