5wxm/1/1:U/1:V

Sequences

>5wxm-a1-m1-cU (length=27) [Search sequence]

GPLQKAHSEISELYANLVYKLDVLSSV

>5wxm-a1-m1-cV (length=32) [Search sequence]

GPLQKAHSEISELYANLVYKLDVLSSVHFVPK

Structure information

PDB ID	5wxm (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the Imp3 and Mpp10 complex
Assembly ID	1
Resolution	2.304Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	24
Sequence identity between the two chains	1.0
PubMed citation	28244370

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	U	V
UniProt accession	P47083	P47083
Species	559292 (Saccharomyces cerevisiae S288C)	559292 (Saccharomyces cerevisiae S288C)
Function annotation	BioLiP:5wxmV

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5wxm-a1-m1-cU_5wxm-a1-m1-cV.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5wxm-assembly1.cif.gz