5wxm/1/1:U/1:V

Sequences
>5wxm-a1-m1-cU (length=27) [Search sequence]
GPLQKAHSEISELYANLVYKLDVLSSV
>5wxm-a1-m1-cV (length=32) [Search sequence]
GPLQKAHSEISELYANLVYKLDVLSSVHFVPK
Structure information
PDB ID 5wxm (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the Imp3 and Mpp10 complex
Assembly ID 1
Resolution 2.304Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 24
Sequence identity between the two chains 1.0
PubMed citation 28244370
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID U V
UniProt accession P47083 P47083
Species 559292 (Saccharomyces cerevisiae S288C) 559292 (Saccharomyces cerevisiae S288C)
Function annotation BioLiP:5wxmV
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5wxm-a1-m1-cU_5wxm-a1-m1-cV.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 5wxm-assembly1.cif.gz

[Back to Home]