5x29/1/1:A/1:E

Sequences
>5x29-a1-m1-cA (length=58) [Search sequence]
ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLAAYAANIVNVSLVKPTVYVYSRVKNL
>5x29-a1-m1-cE (length=58) [Search sequence]
ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLAAYAANIVNVSLVKPTVYVYSRVKNL
Structure information
PDB ID 5x29 (database links: RCSB PDB PDBe PDBj PDBsum)
Title NMR structure of the SARS Coronavirus E protein pentameric ion channel
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 21
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A E
UniProt accession P59637 P59637
Species
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5x29-a1-m1-cA_5x29-a1-m1-cE.pdb.gz
Full biological assembly
Download: 5x29-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5x29/1/1:A/1:B 5x29/1/1:B/1:C 5x29/1/1:C/1:D 5x29/1/1:D/1:E
Other dimers with similar sequences but different poses
  • 7k3g/1/1:D/1:E 7k3g/1/1:A/1:B 7k3g/1/1:A/1:E 7k3g/1/1:B/1:C 7k3g/1/1:C/1:D
  • [Back to Home]