5x9g/1/1:A/1:D

Sequences

>5x9g-a1-m1-cA (length=248) [Search sequence]

LAVSLQEALQEGDTRALREVLEEIHPQDLLALWDELKGEHRYVVLTLLPKAKAAEVLSHL
SPEEQAEYLKTLPPWRLREILEELSLDDLADALQAVRKEDPAYFQRLKDLLDPRTRAEVE
ALARYEEDEAGGLMTPEYVAVREGMTVEEVLRFLRRAAPDAETIYYIYVVDEKGRLKGVL
SLRDLIVADPRTRVAEIMNPKVVYVRTDTDQEEVARLMADYDFTVLPVVDEEGRLVGIVT
VDDVLDVL

>5x9g-a1-m1-cD (length=248) [Search sequence]

Structure information

PDB ID	5x9g (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the cytosolic domain of the Mg2+ channel MgtE in complex with ATP
Assembly ID	1
Resolution	3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	26
Sequence identity between the two chains	1.0
PubMed citation	28747715

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	D
UniProt accession	Q5SMG8	Q5SMG8
Species	300852 (Thermus thermophilus HB8)	300852 (Thermus thermophilus HB8)
Function annotation	BioLiP:5x9gA	BioLiP:5x9gD

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	5x9g-a1-m1-cA_5x9g-a1-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	5x9g-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

2zy9/1/1:A/1:B 2yvx/1/1:A/1:B 2yvx/2/1:C/1:D 4u9l/1/1:B/1:A 4u9n/1/1:A/1:B 4wib/1/1:A/1:B 5x9h/1/1:B/1:A 6lbh/1/1:A/1:B 8h5e/1/1:A/1:B

5x9g/1/1:B/1:D 5x9g/1/1:C/1:A