5xnm/1/1:M/1:m

Sequences

>5xnm-a1-m1-cM (length=33) [Search sequence]

MEVNILAFIATALFILVPTAFLLIIYVKTVSQS

>5xnm-a1-m1-cm (length=33) [Search sequence]

MEVNILAFIATALFILVPTAFLLIIYVKTVSQS

Structure information

PDB ID	5xnm (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of unstacked C2S2M2-type PSII-LHCII supercomplex from Pisum sativum
Assembly ID	1
Resolution	3.2Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	46
Sequence identity between the two chains	1.0
PubMed citation	28839073

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	M	m
UniProt accession	P69529	P69529
Species	3888 (Pisum sativum)	3888 (Pisum sativum)
Function annotation	BioLiP:5xnmM	BioLiP:5xnmm

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 5xnm-a1-m1-cM_5xnm-a1-m1-cm.pdb.gz

Full biological assembly Download: 5xnm-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3jcu/1/1:M/1:m 5mdx/1/1:M/1:m 5xnl/1/1:M/1:m 6yp7/1/1:M/1:m 7oui/1/1:M/1:m